PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009597401.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family VOZ
Protein Properties Length: 477aa    MW: 53267.2 Da    PI: 5.8624
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009597401.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ410.63.1e-1261984171217
             VOZ   1 pppsaflgpkcalwdctrpaqgsewl...qdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwna 92 
                     pp saflgpkcalwdc+rpa gs+w+   qdycs +ha+la neg +g  pv+rp gi+lkd+llf+al ak++gk+vg+pecegaatakspwna
  XP_009597401.1 198 PPASAFLGPKCALWDCPRPAMGSDWCqksQDYCSDYHASLAPNEGYLGRPPVVRPMGIGLKDNLLFQALGAKAHGKDVGVPECEGAATAKSPWNA 292
                     789**********************944459**************************************************************** PP

             VOZ  93 aelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlel 187
                     +elfdl+++egetirewlffdkprrafesgnrkqrslpdy+grgwhesrkq+m+efgglkrsyymdpqp++++ewhlyeyein++da+alyrlel
  XP_009597401.1 293 PELFDLKVVEGETIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQMMNEFGGLKRSYYMDPQPMKNLEWHLYEYEINKYDACALYRLEL 387
                     *********************************************************************************************** PP

             VOZ 188 klvdekksakgkvskdsladlqkklgrlta 217
                     klvd+kk +kgkv++ s++dlqk++grlta
  XP_009597401.1 388 KLVDGKKIPKGKVTNVSVSDLQKQMGRLTA 417
                     ****************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MRKLSKRGAC KSASHQLFKD RAKNRVDDLQ GVLTNLQSAR KESRSYDVGL LEEQVHQMLR  60
EWKAELNEPS PASSLQGGSL VSSSDIYRLL LGEEEDDATS ALAAPKPEPD AQKVSVTDFQ  120
EGFNATQVLH EQGFQLVDQC KGLPSVVNSA GINNLGIATQ LDYHSFDLHQ EYDQQYLPGF  180
DALNLCLEDA LPPIHISPPA SAFLGPKCAL WDCPRPAMGS DWCQKSQDYC SDYHASLAPN  240
EGYLGRPPVV RPMGIGLKDN LLFQALGAKA HGKDVGVPEC EGAATAKSPW NAPELFDLKV  300
VEGETIREWL FFDKPRRAFE SGNRKQRSLP DYNGRGWHES RKQMMNEFGG LKRSYYMDPQ  360
PMKNLEWHLY EYEINKYDAC ALYRLELKLV DGKKIPKGKV TNVSVSDLQK QMGRLTAEFP  420
LDNKRTVKGR SKAASLKNVG NIQAAPIPMV LTCEGFDYGT GESYDYLVDD LDGYFIT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0145160.0BT014516.1 Lycopersicon esculentum clone 133906R, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009597399.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_009597400.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_009597401.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLK4CY640.0K4CY64_SOLLC; Uncharacterized protein
STRINGSolyc10g008880.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein